Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.

Belongs to the fatty acid desaturase type 1 family.

single

404 amino acids

FKFRQSPSSPRFRLNSRNWALNVTTPLTVDSSSSPPIEEEPKTQRFDPGAPPPFNLADIRAAIPKHCWVKNPWKSMSYVVRELAIVFALAAGAAYLNNWLVWPLYWIAQGTMFWALFVLGHDCGHGSFSNDPRLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPMSEKIYKSLDKPTRFFRFTLPLVMLAYPFYLWARSPGKKGSHYHPDSDLFLPKERNDVLTSTACWTAMAVLLVCLNFVMGPMQMLKLYVIPYWINVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGLINNIHHDIGTHVIHHLFPQIPHYHLVEATEAAKPVLGKYYREPDKSGPLPLHLLGILAKSIKEDHFVSDEGDVVYYEADPNLYGEIKVTAE

46.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FAD7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here