Many of the major pollen coat proteins are derived from endoproteolytic cleavage of oleosin-like proteins.

Belongs to the oleosin family.

single

183 amino acids

QASIFSRFFRMFSFIFPFVNVIKLIIASVTSLVCLAFSCVALGGSAVALIVSTPLFIMFSPILVPATIATTLLASGLMAGTTLGLTGIGLIMGLVRTAGGVSLLQSPLRKIIVNRIKARLGGGGGGSRLARLKKILGLLNKLRGMGAGGAAAPAAEPAPAAEAAPAAEAAPAAAPAAAPAAAP

18.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OlnB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here