May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites.

Belongs to the bZIP family.

151 amino acids

MSSSSLSPTAGRTSGSDGDSAADTHRREKRRLSNRESARRSRLRKQQHLDELVQEVARLQADNARVAARARDIASQYTRVEQENTVLRARAAELGDRLRSVNEVLRLVEEFSGVAMDIQEEMPADDPLLRPWQLPYPAAAMPMGAPHMLHY

17 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OBF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here