Protein expression services for nap1l1-b | Nucleosome assembly protein 1-like 1-B
Description
Acts as a chaperone for the linker histone to facilitate deposition of histone B4 onto linker DNA. Required for both remodeling of sperm chromatin into nucleosomes, and linker histone binding to nucleosome core dimers. Plays a role in tissue-specific gene regulation. Required for primitive hemopoiesis, acting upstream of tal1/scl.
Family
Belongs to the nucleosome assembly protein (NAP) family.
Species
Xenopus laevis
Length
393 amino acids
Sequence
MANIDNKEQTELDQQDMEDVEDVEEEETGEEANSKARQLTAQMMQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPFFEKRSDIINASYEPTEEECEWKVDEEEDIAEDLKEKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMNFMLEFHFEPNEFFTNELLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENGELDDDAEAILTADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADDEEGEEEADEDHDPDFDPKKAQNPAECKQQ
Mass
45.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make nap1l1-b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here