Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors (By similarity).

Belongs to the Nup35 family.

308 amino acids

MEIQSCIEPMTLGSPTSPKPGAQFLPGFLMGDLPAPVTPQPRSFGLTGGAEIRSPLLAGGSPPQPVVPTPKDKSGAPPVRSIYDDLNGSAVGMSPLAARKQPFAGVHTPLSGLQGTPGTVSNFFSPVSQQRKTTLSPAQVDPFFTQGDALSSEDQLDDTWITVFGFPPASASYILLQFAQYGNILKHVMSNTGNWMHVQYQSKLQARKALSKDGKIFGEAIMIGVKPCIDKSVMESLDKGSTSSSVFTPPVKAPCTPSHPLSTPRSVMRPLSAAYKASSSDYQVVSDQQTPKKDESFVSKAMEYMFGW

32.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nup35 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here