Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.

Belongs to the YbaB/EbfC family.

107 amino acids

MKNLAGLMKQATQMQARMEEMQSKLEGMTIEGSAGAGMVHVTLNGKGDMKAVKIDPKLADPAEMEMLQDLIVAACADARKLLDERASEEMKKVTGGMNLPAGLKFPF

11.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GDI3467 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here