Protein expression services for ntmt1-b | N-terminal Xaa-Pro-Lys N-methyltransferase 1-B
Description
Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Gly/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exposed alpha-amino group of the Ala, Gly or Ser residue in the [Ala/Gly/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on target proteins.
Family
Belongs to the methyltransferase superfamily. NTM1 family.
Species
Xenopus laevis
Length
223 amino acids
Sequence
MSTELVEDETQFYGKAQNYWKNVPATVDGMLGGYGHISNTDLNSSKKFLQRFLREGSQKTGNTCALDCGAGIGRITKRLLLPLFKTVDMVDVTDEFLNKAKSYLGEEGKRVGKYFCCGLQEFSPEPSRYDVIWIQWVIGHLTDEHLVSFLQRCKLGLRPNGIILIKDNVTQDGSIMDDADSSICRDIDLVRKLIKQAGLSVLAIERQENFPDEIYQVFSFAMR
Mass
25.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ntmt1-b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here