Hydrolyzes N-substituted formamides, but not amides. N-benzylformamide is the preferred substrate, while N-butylformamide is hydrolyzed at a much lower rate. Has very low activity towards allylformamide, N-(2-cyclohex-1-enylethyl)formamide and N-(alpha-methylbenzyl)formamide.

Belongs to the metallo-dependent hydrolases superfamily.

542 amino acids

MTQMRDLMIINANVRTVDARNSCAQAVLVSGGRIAIVGTETEVRGAAAPDAEVLDVSGKTVVPGFIDAHNHLSVAAFAPDSVDCSTPPLATLDEVLEVIERHCRNIPPGQWVRGINFHASHIREQRNPTRYELDEVAPNNPFFLIDASCHAGFANSAALDLVGIGAHTPEPWGGEIERDLSGKPTGTLLEAAANLLHSASWNDYAERDWDRAVELLHSKMNDYLAVGLTGVGDAMVTAKSAELYRRADAAGKMPFTLQQLHGGDHFFSMQDLGRSDTVDRIMEPESYLLRGGAMKIFVDRAYPSPAIDQIHDGCKTHVGANFYSKSEVHDLAVRASKLGINLAIHGMGNCAIDIVLDAYEAVRRQSNADTVLRLEHAFIAETGQGQRMADLGIDLVANPGLAFGWGEVFNMWRGENQEHLKLFPVRSMLDAGVRVSLASDHPCGTYSPAEIMWTAVARETMAGAPLEPDEAVTADEALRMYTINPAHASGRGSEEGSIEAGKRANLLVLDRDPVDCATGELRELQVLRTYVDGVLRYERTGS

58.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nfdA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here