Lipid transfer protein that, together with LTPG2, binds to lipids and functions as a component of the cuticular lipid export machinery that performs extensive export of intracellular lipids (e.g. C29 alkane) from epidermal cells to the surface to build the cuticular wax layer and silique walls. Involved in the establishment of resistance to the necrotrophic fungal pathogen Alternaria brassicicola.

Belongs to the plant LTP family.

193 amino acids

MKGLHLHLVLVTMTIVASIAAAAPAAPGGALADECNQDFQKVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLIQLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATTTPVAPAGKSPATPATSTDKGGSASAKDGHAVVALAVALMAVSFVLTLPRHVTLGM

19.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make LTPG1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here