This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Possesses a wide variety of biological activities (By similarity).

Belongs to the pancreatic ribonuclease family.

160 amino acids

MVPKLFTSPICLLLLLGLMGVEGSLHAKPGQFTWAQWFEIQHINMTSGQCTNAMLVINNYQRRCKNQNTFLLTTFADVVHVCGNPSMPCPSNTSLNNCHHSGVQVPLIHCNLTTPSQNISNCKYTQTTANKFYIVACNNSDPVRDPPQYPVVPVHLDRVI

17.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RNASE2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here