Non-lysosomal glucosylceramidase that catalyzes the hydrolysis of glucosylceramide (GlcCer) to free glucose and ceramide (By similarity). Glucosylceramides are membrane glycosphingolipids that have a wide intracellular distribution. They are the main precursors of more complex glycosphingolipids that play a role in cellular growth, differentiation, adhesion, signaling, cytoskeletal dynamics and membrane properties. Also involved in the transglucosylation of cholesterol, transferring glucose from glucosylceramides, thereby modifying its water solubility and biological properties. Under specific conditions, may catalyze the reverse reaction, transferring glucose from cholesteryl-beta-D-glucoside to ceramide (By similarity). Finally, may also play a role in the metabolism of bile acids. It is able to hydrolyze bile acid 3-O-glucosides but also to produce bile acid-glucose conjugates thanks to a bile acid glucosyl transferase activity (By similarity). However, the relevance of both activities is unclear in vivo (By similarity).

Belongs to the non-lysosomal glucosylceramidase family.

912 amino acids

MVTCVPASEQIGCAERDSQIYSEDTGGTEAVRVTDCRSPEDSGPQNEPGYCNSEDSGQLMASYEGKARGYQVPPFGWRICLAHEFAEKRKPFQANNVSLSNLVKHFGMGLRYLKWWYRKTQVEKKTPFIDMFNSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVIADQFIVCLRRDGRTVYQQVLSLELPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLTCRQITPILPHDYQDSSLPVGVFVWDVENEGDETLDVSIMFSMRNGLGGEDDAAGGLWNEPFRLEQDGTTVQGLLLHHPTPPNPYTMAVAARHTADTTVTYTTAFDPDSTGQQVWQDLLQDGQLDSPAGQSTPTQRGEGVAGAVCASSKLLPRGRCCLEFSLAWDMPRIMFGAKGQVHYRRYTRFFGSDGDVAPALSHYALCQYAGWENSISAWQNPVLDDRSLPAWYKSALFNELYFLADGGTVWLEVPEDSLPEELGGSMYQLRPILQDYGRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERLLWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALKTIFELNVQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKNSSRPAVTQGTAPSQPECGPKRSL

102.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Gba2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here