Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860' (By similarity).

Belongs to the class V-like SAM-binding methyltransferase superfamily.

435 amino acids

MKKEGIEGTERFLSPGKGRGLKAIKHFKVGDLVFACPAYAYVLTVNERGGRCECCFTRKEGLSKCGKCKQAYYCNVECQRGDWPMHKLECSAMCAYGENWCPSETVRLVARIILKQKHQTERTPSERVLTLRELEAHLDKLDNEKNEMNDTDIAALHHFYSRHLDFPDNAALTELIAQVNCNGFTIEDEELSHLGSALFPDVALMNHSCSPNVIVTYKGTVAEVRAVQEINPEEEIFNSYIDLLYPTEDRIERLKDSYFFNCDCKECTSKSKDEAKMEIRQKLSIPPEEEEIKQMVIYARNVIEEFRRAKHYKTPSELLEICELSMEKMGAIFAETNVYMLHMMYQAMGVCLYMQDWDGAMKYGEKIIHPYSVHYPPYSLNVASMYLKLGRLYLGLEKRTQGVKALKKALAIMDIAHGKDHPYIDEIKKEMEEQT

50.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make smyd2a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here