Catalyzes the oxidation of alkyl nitronates to produce the corresponding carbonyl compounds and nitrites. Anionic forms of nitroalkanes are much better substrates than are neutral forms.

Belongs to the nitronate monooxygenase family. NMO class II subfamily.

378 amino acids

MHFPGHSSKKEESAQAALTKLNSWFPTTKNPVIISAPMYLIANGTLAAEVSKAGGIGFVAGGSDFRPGSSHLTALSTELASARSRLGLTDRPLTPLPGIGVGLILTHTISVPYVTDTVLPILIEHSPQAVWLFANDPDFEASSEPGAKGTAKQIIEALHASGFVVFFQVGTVKDARKAAADGADVIVAQGIDAGGHQLATGSGIVSLVPEVRDMLDREFKEREVVVVAAGGVADGRGVVGALGLGAEGVVLGTRFTVAVEASTPEFRRKVILETNDGGLNTVKSHFHDQINCNTIWHNVYDGRAVRNASYDDHAAGVPFEENHKKFKEAASSGDNSRAVTWSGTAVGLIKDQRPAGDIVRELREEAKERIKKIQAFAA

39.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ncd-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here