FixG is predicted to be involved in a redox process. The four proteins FixG, FixH, FixI, and FixS may participate in a membrane-bound complex coupling the FixI cation pump with a redox process catalyzed by FixG.

524 amino acids

MLHQPKTKATVGRLDAETVNAARVRGPLYEKRRKIFPKRAEGRFRRFKWLVMLVTLGIYYLTPWIRWDRGAHAPDQAVLIDLASRRFYFFFIEIWPQEFFFVAGLLVMAGFGLFLVTSAVGRAWCGYACPQTVWVDLFLVVERFIEGDRNARMRLDAGPWSLDKIRKRVAKHAIWVAIGVATGGAWIFYFADAPSLMSSLVALDAPPVAYTTIGILTATTYVFGGLMREQVCTYMCPWPRIQAAMLDENSLVVTYNDWRGEPRSRHAKKAAAAGEVVGDCVDCNACVAVCPMGIDIRDGQQLECITCALCIDACDGVMDKLGRERGLISYATLSDYAANMALATSGGTAAIDPSRVRNAHGAFRDKVRHLNWRIVFRPRVLVYFGVWATVGFGLLFGLLARDRLELNVLHDRNPQFVVESDGSVRNGYMVKLLNMIPEQRTISLTIEGMPAATMRVAGQATGDGRRVTIGVEPDKVTPLKVFVTLPKGRFAEAEEGFSLIAEDPSSHERDVYQANFNLPGAAGR

58.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fixG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here