Catalyzes the reduction of nicotine blue to its hydroquinone form. Nicotine blue is the name given to the compound formed by the autocatalytic condensation of two molecules of 2,3,6-trihydroxypyridine, an intermediate in the nicotine degradation pathway. May play a role in preventing the intracellular formation of nicotine blue semiquinone radicals, which by redox cycling would lead to the formation of toxic reactive oxygen species. Besides nicotine blue, several other quinones are reduced by nboR.

204 amino acids

MGDTDLPCVTGVLLAAGAGKRLGRGPKALLPYRGRTLVEDAAETMLVGGCHEVVIVLGANAQAVCARANLEPYRIVVNHDWSSGMGSSYLAGDAAAHTKNHILVALVDQPGLSVTTVGRLLVSHRPGRISSAAYSSLDSPRVLRRGHPMVIDAGLRPAVASTVSGDAGARVFLRQKPWLVDLIDCSDESTGEDVDTVEQMYRLL

21.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nboR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here