Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate. Helps prevent cellular oxidative stress via its role in NAD biosynthesis.

Belongs to the NAPRTase family.

546 amino acids

MATSNEAGSVLNRVPPLLTDLYQMAYAYWRAGRHNEPAVFELFFRDNPFGGGFSLFAGLSDCLLFLQNFSFSDDDVQYLRSVLPADTDAGFFSYLKELDCSCVSVSAVPEGSVVFARVPLLEVSGPLAVVQLLETSLLCLVNYASLVCSNAARFRLAAGPRRRLMEMGLRRAQGPDGGLTASRYTYIGGFDLTSNALAGRLYGIPVAGTMAHSYITSFSSLEEVWPQTLKPCGGGDSIDFICLVKGLLGRVCQLLGSKTNLIREGELAAFLSYAIAYPQNFLPVIDSYSVRCSGLLCFCAVALALFELQYRPLGVRLDSGDLCRQSLDVRRVFRECSKHFSVPQFESLIIVGTNSISEQSLSELNKKDNEIDVVGVGTHLVTCTRQPSLGCVYKLVEVRGRPRMKLSEDPEKSTLPGRKAVYRLLDADGHPQMDVLCLCDEAAPAAGVELQCFSLLGNSTLQCSITPAQVSSLRTQVFSCGQITLPLNSASESRERAQISLQMLNPYHKRLQEPHNYTVALSERLHSLVSDIKKGNSKGSNFLLSN

59.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make naprt using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here