Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). Reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin. Involved in the regulation of PXN at the protein level and of PXN tyrosine phosphorylation. May play a role in the regulation of terminal myogenesis (By similarity).

Belongs to the uridine kinase family. NRK subfamily.

195 amino acids

MKLIIGIGGVTNGGKTTLTNSLLKALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESLDMETMLSTVQAWVKDPHKFARAHGVSLQSGASDTHVLLLEGFLLYSYRPLVDLYSQRYFLTVPYEECKRRRRSRTYMVPDPPGLFDGHVWPMYQKYRREMEQDGVEVVYLDGMKSPEGLFHQVLEDIQNRLLNTS

22.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Nmrk2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here