Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.

Belongs to the nicotianamine synthase (NAS)-like family.

320 amino acids

MACENNLVVKQIMDLYNQISNLESLKPSKNVDTLFRQLVSTCLPTDTNIDVTEIHDEKVKDMRSHLIKLCGEAEGYLEQHFSAILGSFEDNPLNHLHIFPYYNNYLKLGKLEFDLLSQHTTHVPTKVAFIGSGPMPLTSIVLAKFHLPNTTFHNFDIDSHANTLASNLVSRDSDLSKRMIFHTTDVLNAKEGLDQYDVVFLAALVGMDKESKVKAIEHLEKHMAPGAVVMLRSAHGLRAFLYPIVDSCDLKGFEVLTIYHPSDDVVNSVVIARKLGGSNGARGSQIGRCVVMPCNCSKVHAILNNRGMEKNLIEEYSAIE

35.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NAS2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here