NT-4 could play a role in oogenesis and/or early embryogenesis. NT-4 interacts with the low affinity NGF receptor and elicits neurite outgrowth from explanted dorsal root ganglia with no and lower activity in sympathetic and nodose ganglia, respectively.

Belongs to the NGF-beta family.

236 amino acids

MILRLYAMVISYCCAICAAPFQSRTTDLDYGPDKTSEASDRQSVPNNFSHVLQNGFFPDLSSTYSSMAGKDWNLYSPRVTLSSEEPSGPPLLFLSEETVVHPEPANKTSRLKRASGSDSVSLSRRGELSVCDSVNVWVTDKRTAVDDRGKIVTVMSEIQTLTGPLKQYFFETKCNPSGSTTRGCRGVDKKQWISECKAKQSYVRALTIDANKLVGWRWIRIDTACVCTLLSRTGRT

26.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ntf4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here