Seems to promote the survival of visceral and proprioceptive sensory neurons.

Belongs to the NGF-beta family.

single

165 amino acids

IQSTSMDQGSLSEDSMNSLLRTLIKADIWKNKVSKQMAGTKDDIQTTVKKTDAEADAIENKNMRLGFQPVVSVDAELLRQQRRFSSPRVLLSENTPLEPPPLYLMEDPMVLNRTSRRKRFAEGKSHRGEYSVCDSESRWVTDKSSAVDIRGHQVTVLGEIRMGPS

18.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NTF3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here