Neuroendocrine regulatory peptide-2: Plays a role in the control of body fluid homeostasis by regulating vasopressin release. Activates GABAergic interneurons which are inhibitory neurons of the nervous system and thereby suppresses presynaptic glutamatergic neurons (By similarity). Stimulates also feeding behavior in an orexin-dependent manner in the hypothalamus (By similarity). Functions as a positive regulator for the activation of orexin neurons resulting in elevated gastric acid secretion and gastric emptying (By similarity).

618 amino acids

MKSLRLPATVLFCLLLLIKGLGAAPPGHPEAQPPPPSSEHKEPVAGDAVLGSKDVSALEVRAARNSEPQDEGELFQGVDPRALAAVLLQALDRPASPPAPGGSQQRPEEETAESLLTETVRSQTHSLPVPETQAPAAPPRPQTQENGAEAPDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPPAPPQFQARVPESGPLPEAHQFGGGSSPKTHLGEALAPLSKAYQGLAAPFPKARRPETSLLGGTEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRGLQEEEGGGRETARQQEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEEGEAGAEDKRSREETPGHRRKEAEGAEEGGAEDEDDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEPVPPPRAAPAPTHARSPKTPPPAPAPDREELPDGNEELPPRDRXENEVFSPVPYHPFPNYIRARTVQPPPASRRRHYHHALPPSRHYPDREAQARRAQEEAEAEERRLQEQEELENYIEHVLLRRP

67.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make VGF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here