After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Nicotinic acetylcholine receptor in the MC pharyngeal motor neuron involved in pharyngeal pumping. Has a role in the determination of life span possibly via calorific restriction which affects growth rate, although this is independent of metabolic activity (By similarity).

Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily.

481 amino acids

MFLLLQILYILLFLNLADTSDDEYRLLKDLREGYDPMERPVSDHMKPVNVKLRLILQQLVDVDEKNQVITLVVWTQYTWNDYKMKWSPEEYGNITSLQIPFGTLWKPDILLFNSANEHFDSSFPVNMVVSNDGNVLFAPPGIMQFSCSLSMTWFPYDEQVCYLKFGSWTYGKKLDLRIDDADLPEGHKMDLQYYVPNGEFDLISTPAFRKSTTFLDETYVELYFHMHLKRRTMYYGLNWIIPSILISLSNILGFTMPVECGEKVTLQITNFLSIMVFLAMVSEVAPPTSESIPIIAAFFSFAIVILGVSICVSLITVNIFYRHPKMHRMGDWTRYIFLEWLPWFLLMSRPDHVFRKPKREKKKEEEEDEESNAGGKEEESELISQKQQRPRLLVNSQIVMDSTIPYLEEVIGYLKVFKAKLDDDEEEEEEILNWRFMAMVIDRASLFLFTGLIFGTTFVIFAACPNLFSADQIIETEPVIT

56 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make eat-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here