Probably acts as a transcriptional activator. Mediates neuronal differentiation. Required for the regulation of amacrine cell fate specification in the retina (By similarity).

330 amino acids

MTKTYTKAKEMAELVGTQGWMDDALSSKDELKAENGRPGPFGLVAGLNEEHDSIEEEEEEEDDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKSFVEMLCKGLSQPTSNLVAGCLQLGPQTLFLEKHEEKTPGCESAISSHSFTYQSPGLPSPPYGSMETHLLHLKPPAFKSLVDASFGNPPDCTTPPYEGPLTPPLSISGNFSLKQDGSPDLDKPYAFMAHYPSVSLAGAHGHPTHFQNAVPRYEIPIDMSYESYPHHVAGPQLNAIFNE

36.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NEUROD4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here