May act as a tumor suppressor. Cytokine that has an axial patterning activity. Acts like bone morpho-genetic protein (BMP) antagonist in embryonic explants. Blocks the bmp2 activity (By similarity).

Belongs to the DAN family.

176 amino acids

MTVWLLIGFLLPVAIFAAPPINRLALFPDKSAWCEAKNITQIVGHSGCESKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPIDSVWDVVTLECPGNEEFPRVDKLVEKILQCSCQACGKELSQEGAMFNVYLNTAEETLSPAETLGHHHHRPPAREEDSPAQSQREGESEE

19.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nbl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here