Negative regulator of replication initiation, which contributes to regulation of DNA replication and ensures that replication initiation occurs exactly once per chromosome per cell cycle. Binds to pairs of hemimethylated GATC sequences in the oriC region, thus preventing assembly of replication proteins and re-initiation at newly replicated origins. Repression is relieved when the region becomes fully methylated.

Belongs to the SeqA family.

180 amino acids

MKYIEIDDELYRYIASNTQQIGESASDILRRLLGLEVTAEAESIPERISEPSMEGVEEAAPVRSAVAEAGVFEELVDDEQLPRQKGAVGRFLYLLDCLYRQHPSAFDGVLAIRGRDRLYFSQSKEALLKASPSANPKQIGASPFWVSANNNTAKKRAILEEVLEILGCQKALAARIAEQV

19.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make seqA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here