About Products Protein Database Contact

Protein expression services for seqA | Negative modulator of initiation of replication

Description
Negative regulator of replication initiation, which contributes to regulation of DNA replication and ensures that replication initiation occurs exactly once per chromosome per cell cycle. Binds to pairs of hemimethylated GATC sequences in the oriC region, thus preventing assembly of replication proteins and re-initiation at newly replicated origins. Repression is relieved when the region becomes fully methylated.
Family
Belongs to the SeqA family.
Species
Shewanella halifaxensis (strain HAW-EB4)
Length
186 amino acids
Sequence
MKYIEVDEELYRHIASKTEHIGESASDILRRILGLQVESVVQDAPEEISHPSLERVSPKPVKVAKVITKMTSTAVSDFTSLIDADVLAAQKGAVGRFLFILDTVHRASPVQFEQVLQIQGRDRLYFATSKDALLKASKSANPKEIGQSGFWVTTNNNTAKKRTILSEVLLQFGTDEAQVTDIIEKI
Mass
20.6 kDa
Simulated SDS-PAGE
Western blot of seqA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make seqA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here