Component of the NC2 complex which represses RNA polymerase II transcription through binding to SPT15/TBP and thereby inhibiting the assembly of the preinitiation complex. The NC2 complex may also mediate transcriptional activation from TATA-driven promoters through association with SPT15/TBP.

Belongs to the NC2 alpha/DRAP1 family.

142 amino acids

MADQVPVTTQLPPIKPEHEVPLDAGGSPVGNMGTNSNNNNELGDVFDRIKTHFPPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEILKKTILNDEKFDFLREGLCVEEGQTQPEEESA

15.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BUR6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here