In vitro, is able to catalyze the acetylation of beta-lysine to N6-acetyl-beta-lysine, an archaeal osmolyte produced by methanogenic archaea. Its physiological function has not yet been elucidated.

Belongs to the acetyltransferase family.

275 amino acids

MLKSIKSSGVTAVLDHDGFNKRIRVVRYDGAIEKALPDIVAAAKEENAEKIIVYAKQHDEPILAKQLFAPEGYLKGYYLGHSACVMVRYLSESRRQTDSYTEEQEIIEAIYRTAPRLRNDSTPVFTMRKAETNDMYQLSMLYKKVFRTYPTPVFDPAYIEKTMNANTVYYIMLDHDRLISAASAEINPELGHAEITDCAVLPEYRGHSLTSFLIEALEKEMAGEDIVHVFSLARASSFGMNAVLYHSGYQYGGRLINNCFIAEGLENMNIWCKQL

31.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make yodP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here