About Products Protein Database Contact

Protein expression services for nanM | N-acetylneuraminate epimerase

Description
Converts alpha-N-acetylneuranimic acid (Neu5Ac) to the beta-anomer, accelerating the equilibrium between the alpha- and beta-anomers. Probably facilitates sialidase-negative bacteria to compete sucessfully for limited amounts of extracellular Neu5Ac, which is likely taken up in the beta-anomer. In addition, the rapid removal of sialic acid from solution might be advantageous to the bacterium to damp down host responses.
Family
Belongs to the NanM family.
Species
Vibrio vulnificus (strain YJ016)
Length
384 amino acids
Sequence
MMKTKYLLLPLLASSSLLSHMAFANNHWPDLPIGVKNGVSAQIGSKVYVGLGSAEKSFYVLDTQAPQNGWTLLAEFIGPERSGATATVVGENIFVFGGSGKASDDASSPIIFDTVYRFDTQTNRWHQVKTQTPVGLLGASSYSPDGKQVLFFGGYSKPLFDKYLADITRTDKKAQPEQWQKIVDDYMGMEPLAYQWNRDVLSFNPTNDKWDVVTRSPYLPNCGSATVIDGPSITLISGEIKPGLRTAEVKTFTYGELQPWQSTYALPAAKGQAQQEGIAGAYSGVVSNTLLVAGGANFHGAKAQFESGQMFAHNGLSKAYNSEIYAKQKGVWQQVGQLPEGLAYGASFSVKGGVLMVGGERADRTASTKVYLVGLNNNQIDIVD
Mass
41.5 kDa
Simulated SDS-PAGE
Western blot of nanM recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make nanM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here