Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation.

Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.

297 amino acids

MVNIIQDFIPVGANNRPGYAMTPLYITVHNTANTAVGADAAAHARYLKNPDTTTSWHFTVDDTEIYQHLPLNENGWHAGDGNGSGNRASIGIEICENADGDFAKATANAQWLIKTLMAEHNISLANVVPHKYWSGKECPRKLLDTWDSFKAGIGGGGSQTYVVKQGDTLTSIARAFGVTVAQLQEWNNIEDPNLIRVGQVLIVSAPSAAEKPELYPLPDGIIQLTTPYTSGEHVFQVQRALAALYFYPDKGAVNNGIDGVYGPKTADAVARFQSVNGLTADGIYGPATKEKIAAQLS

31.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xlyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here