About Products Protein Database Contact

Protein expression services for murQ | N-acetylmuramic acid 6-phosphate etherase

Description
Specifically catalyzes the cleavage of the D-lactyl ether substituent of MurNAc 6-phosphate, producing GlcNAc 6-phosphate and D-lactate. Together with AnmK, is also required for the utilization of anhydro-N-acetylmuramic acid (anhMurNAc) either imported from the medium or derived from its own cell wall murein, and thus plays a role in cell wall recycling.
Family
Belongs to the GCKR-like family. MurNAc-6-P etherase subfamily.
Species
Escherichia coli (strain SMS-3-5 / SECEC)
Length
298 amino acids
Sequence
MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGGVNDLKNIGLTAQDVVVGIAASGRTPYVIAGLEYAHQLGCRTVGISCNPGSAVSTTAEFAITPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVNIVKNATGCSAEQAETALIACKRNCKTAIVMVLKNLDADEAKKCLDQHGGFIRKALEKE
Mass
31.1 kDa
Simulated SDS-PAGE
Western blot of murQ recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make murQ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here