Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells.

Belongs to the glycosyltransferase 14 family.

401 amino acids

MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF

45.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Gcnt2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here