Involved in the first committed step in the biosynthesis of amino-sugar-nucleotides. Catalyzes the hydrolysis of the N-acetyl group of N-acetylglucosamine-6-phosphate (GlcNAc-6-P) to yield glucosamine 6-phosphate and acetate.

Belongs to the metallo-dependent hydrolases superfamily. NagA family.

399 amino acids

MESKSHAHCFRAQRVLHGKQWQQDAVVTVDENGTISAIESYDGQRHADAIPLGPVDLMPGLIDSHVHGSQGCDVMDATHDSLNTMSRYFATLGVTAFVATTVTAPVAKIRAALAQVAKSKHDGVDGAEILGAYLEGPYFTEKNKGAHPTQWFRELAVEELEDWISYSDNQLLKVALAPEKTGALDAIRYLDAHGIHVMLGHSDADYEQVKAALAAGAKGIVHCYNGMRGLHHRDPGVVGAGLLHPHCFVEMIADGHHVHPAAIDVAHRCCGSRMTLITDAMRATGMPDGQYTLGEYQVDMKQGVVMTSSGGLAGSTLTLLRGVKNIHRWLNVPIEQAWLMASYTPAESLGIQHQLGSLEVGKYASMVAVSSDFSIEKTWVKGRLVFDAATSPRQEALCI

43.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make manD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here