In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2. Recruits PRMT1 to the IL4 promoter; this leads to enhancement of histone H4 'Arg-3'-methylation and facilitates subsequent histone acetylation at the IL4 locus, thus promotes robust cytokine expression (By similarity). Down-regulates formation of poly-SUMO chains by UBE2I/UBC9 (By similarity).

414 amino acids

MAEPLRRRGPRSRGGRASRGARRARAARGRCPRAPRSPTRLIPDTVLVDLVSDSDEEVLEVVADPGEVPVARLPAPAAPEQDSDSDSEGAAEGPAGAPRTLVRRRRRLLDPGEAPVVPVYSGKVQSSLNLIPDNSSLLKLCPSEPEDEADLTDSGSPPSEDALPPGSPWKKKLRKKHEKEEKKMEEFPDQDISPLPQPSSRNKSRKHTEALQKLREVNKRLQDLRSCLSPKQHQSPALQNTDDEVVLVEGSVLPQNPRLFTLKIRCRADLVRLPVKTSEPLQNVVDHMASHLGVSPNRILLLFGETELSPTATPRTLKLGVADIIDCVVLASSSEDTETSQELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPTDLGLESGDLIEVWG

45.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Nfatc2ip using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here