NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo.

Belongs to the sirtuin family. Class III subfamily.

309 amino acids

MCLAQCAARRLLAQVHGALKPAPKKPNWCWEMARPSSNMADFREVFAKAKHIAIITGAGVSAESGVPTFRGAGGFWRKWQAQELATPGAFARNPSRVWEFYHYRREVMLSKHPNAAHIAIAECEKRLRKQGRSVVVITQNIDELHRKAGTKHLLEIHGSLFKTRCTNCGNVTANYKSPICPALAGKGAPDPEIEDAAIPVEELPQCEEDGCHGLLRPHVVWFGETLDPDVLTEVEKELDLCDLCLVVGTSSVVYPAAMFAPQVSARGVPVAEFNMEATPATDRFRFHFEGPCGTTLPPALARHESEIIA

34 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SIRT5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here