About Products Protein Database Contact

Try expressing Sirt6 in cell-free | NAD-dependent protein deacetylase Sirt6

Description
NAD-dependent protein deacetylase (By similarity). May be involved in the regulation of life span.
Family
Belongs to the sirtuin family. Class IV subfamily.
Species
Drosophila melanogaster
Length
317 amino acids
Sequence
MSCNYADGLSAYDNKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSGILYDNVLDWEHDLPENDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKANLIISSYVDVVLSKVCKLLGVEIPEYSEASDPTKQSKPMEWTIPTSNVNTFHRQYKKYVYFIYYLL
Mass
35.2 kDa
Simulated SDS-PAGE
Western blot of Sirt6 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing Sirt6 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here