NAD-dependent protein deacetylase, which is involved in repression of RNA polymerase I-mediated expression immediately adjacent to telomeres. It is however not involved in antigenic variation and subtelomeric variant surface glycoprotein (VSG) gene silencing. Plays a role in DNA damage response. Also has ADP-ribosylation activity in vitro.

Belongs to the sirtuin family. Class I subfamily.

351 amino acids

MTEPKLATTHVVGEPTFEGLARFIERNNITKIFVMVGAGISVAAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYNILMDMDLWPGKYCPTTVHHFISLLAKKGMLLCCCTQNIDGLERACGIPESLLVEAHGSFSSASCVDCHAKYDINMARAETRAGKVPHCNQCGGIVKPDVVFFGENLPEAFFNVAGLIEETELLLILGTSLQVHPFADLALMVPSDVPRVLFNLERVGGRMFRFPTDRTPNFRASSYRLSTGNGNGSKISSGDSSNSSSVDGYDQFTLAENDETGVLRDIFFPGDCQVSVRSFAQALGFGEQLDASVREGREIFERTRRREKVVEG

38.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SIR2rp1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here