Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.

Belongs to the NnrE/AIBP family.

249 amino acids

MPIRYISQKLAQQIDVELMSASGAFSLDQLMELAGLSCAQALAKSFPPTKHKHVMVACGPGNQGGDGLVAARHLHHFSYTPTVYLPKPSSKDFLQRLVKQCENLNIPILKDVDAFQTELAKSDVILDAIFGFSFQPPLRKPFDQVLKAIKGVSKKIPIVSVDIPSGWSVTDGPQPLWTEEDDKGGKEMIETFEPEVLVSLTAPKEGVKAFKGQHWLGGRFVPDELGKKHELNIPPYEGIDQVVELPRNH

27.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CND00610 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here