Pentose reductase with a broad substrate affinity involved in pentose catabolism. Has highest reductase activities with L-arabinose and D-xylose as substrates, and displays much lower activities with D-ribose, D-galactose and D-glucose. Has highest dehydrogenase activity with L-arabitol as substrate, followed by xylitol and D-sorbitol. May be responsible for the first step of the L-arabinose catabolic pathway.

Belongs to the aldo/keto reductase family.

328 amino acids

MAKTSIKLNSGYEMPLVGFGIWKVPVDKTAQAVYDAIKLGYRQIDGAYDYTNSKEAGEGVRRAIEEGIVKREDLFITSKLWNNYHKHEHAIEMAKHEVDTWGIGYLDLFLIHFPISLEYISHSKMPYPCFWPDREKSRSTPLQYTPVAETWAALESLVKTDSNPDGILRSIGVANFRAQLLTDLWGSAKIKPAVNQIEHHPYLVQPQLLAFLKDHGIAITAYSSFGPQSFVELDHPRVSKVEPLFTHPTIKAIADKHGRTGAQVLLRWATQRDIVVIPKSNNVDRLKQNLDCVSFDLSDDEVKQISDLDCGVRFNDPADLSPPIYIFD

37.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PRD1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here