Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

270 amino acids

MSTHSSISQPPLPLAGRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASEINDFPVREEITGKGPRAIVVQANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYPTIADTSVEDFDHTFSVNTKGAFLCSKEAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAASKAAVETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGEAKDVVPLVGFLAGDGGEWVNGQIIPVNGGYV

28.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make At3g03980 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here