Involved in the pathway of tryptophan degradation. Reduces FAD/FMN to FADH(2)/FMNH(2), which are subsequently used for the hydroxylation of anthranilate. It can reduce either FAD or flavin mononucleotide (FMN) but prefers FAD. The enzyme has a slight preference for NADPH as acceptor.

185 amino acids

MKLLGISGTLVGTKTCILVEQVLVEAKRICPEVDIQLLDLKDYQVEFCDGRQQSSYNEDTQKVIELVSVADCYVIGTPIFQGSITGALKNLFDLISPQALRHKVMGFVANGGTYQHYLVIENQLKPIASFFRAFVAPGSVYAHTDHFNEKNELVDPEVRERVAQLAWEVVHMHWSLKSGGVHAHR

20.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GTNG_3158 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here