It seems to function in response to environmental stress when various electron transfer chains are affected or when the environment is highly oxidizing. It reduces quinones to the hydroquinone state to prevent interaction of the semiquinone with O2 and production of superoxide. It prefers NADH over NADPH.

Belongs to the WrbA family.

191 amino acids

MARILVIFHSITGNTMKLAKAVADGAREGGAEVAVKRVPETIPAEILEKNPGYVKVREELESFEVARPEELQDYDAIIFGSPTRFGVMSSQMKQFIDMTGRLWMERRLEGKVGAVFTSNEMPHGGKEATLLSMLLPLFAHGMIIVGLPPAKELYRAGSYYGAASTGVPKEDDLQVAKMLGKRVAEVAEKLC

20.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AF_0343 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here