About Products Protein Database Contact

Protein expression services for ndh-4L | NADH-ubiquinone oxidoreductase chain 4L

Description
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Family
Belongs to the complex I subunit 4L family.
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Length
89 amino acids
Sequence
MNITLILFLIGILGFVLNRKNIILMLISIEIMLLAITFLILVSSLNMDDIIGQTYAIYIIVVAGAESAIGLAILVAFYRLRGSITIEYK
Mass
9.8 kDa
Simulated SDS-PAGE
Western blot of ndh-4L recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ndh-4L using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here