Description
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Family
Belongs to the complex I subunit 4L family.
Sequence
MPIIYTNIVLAFMISLLGMLIYRSHLMSSLLCLEGMMLSLFMMSTLMALNMHFPLANIVPIALLVFAACEAAVGLALLISISNTYGLDHIHNLNLLQC
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service