Description
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Family
Belongs to the complex I 30 kDa subunit family.
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Sequence
MSEEALGELSGYIRERLGDAIEEANLAYGELTLCVPVASLIGVLTFLRDDVQCQFVNLTDISGVDYPQREKRFDVVYQLLSPRQNQRIRVKVQADEDTLVPSAVPVFFGAEWYEREAYDMYGILFSGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYNDELKRVVYEPVQLRQEFRNFDFLSPWEGTDYVLPGDEKAKTN
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service