NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

215 amino acids

MTNGISILPHTQPVYGDAAVAAMAERVVGALGPAVVSHAIAFGELTLVVQASDIVYALTYLRDDPACAFRNFIDICGVDYPQREKRFDVVYHLLSLRHNLRIRLKVQTDEVTPVPSVIEVFPAANWYERETYDLYGILFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDQARVVYEPVQLTQEFRNFDFLSPWEGTDYVLPGDEKTSA

24.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nuoC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here