Component of an enzyme that catalyzes the reduction of free flavins (FMN, FAD and riboflavin) by NADH; the reduced flavins produced by this reaction likely spontaneously react with oxygen, yielding hydrogen peroxide. Is responsible for the major H(2)O(2) production in L.johnsonii in the presence of oxygen. Cannot use NADPH instead of NADH as the electron donor.

Belongs to the NADH-dependent flavin reductase family.

178 amino acids

MKLFAIVGSNADHSYNRDLLNFIKKHFTDRYDIELGEVKDLPMFKEGVKEPAAVASFAKKVADADAVLISTPEQQHSVPSSLKSALEWLSSAEHPFKDKPVVIVGTSVLPQGSARGQSHLKLVLSSPGFGAKVFNGDEFMMGTAPEQFDENGNLPAGTVKFLDHFFDEFDSFYAEVSK

19.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nfr1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here