About Products Protein Database Contact

Protein expression services for Ndufv3 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

Description
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. May be the terminally assembled subunit of Complex I.
Family
Belongs to the complex I NDUFV3 subunit family.
Species
Mus musculus
Length
104 amino acids
Sequence
MAVSLLLRGGRIRALKAVLLEARVFPGELVSVVRLSTESEKSAKEKELHPKTQSVLKEPEPTDTTTYKNLQHHDYNTYTFLDLNLDLSKFRLPQPSSGRESPRH
Mass
11.8 kDa
Simulated SDS-PAGE
Western blot of Ndufv3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Ndufv3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here