Protein expression services for NAM-A1 | NAC transcription factor NAM-A1
Description
Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-B2) and one extra pseudogene (NAM-B1) (PubMed:17124321).
Species
Triticum turgidum subsp. durum
Length
405 amino acids
Sequence
MGSSDSSSGSAQKAARHQHEPPPPRQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTDVSGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSVEDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLEGLFTADDAGLSAGATSLSHLAAAARASPAPTKQFLAPSSSTPFNWLDASPAGILPQARNFPGFNRSRNVGNMSLSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATTGGATSGFQHPVQVSGVNWNP
Mass
43.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make NAM-A1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here