Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype.

406 amino acids

MGSPDSSSGSAQKPPRHQHQHQPPPPRRQGSAPELPPGFRFHPTDEELVVHYLKKKAAKAPLPVTIIAEVDLYKFDPWELPEKATFGEHEWYFFSPRDRKYANGARPNRAATSGYWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRLTGASAGSTTTSRPPPVTGGSRAPASLRLDDWVLCRIYKKTSKAAAAVGDEQRSMECEDSVEDAVTAYPPYATAGMAGAGAHGSNYVQLLHHHDSHEDNFQLDGLLTEHDVGLSAGAASLGHLAAAARATKQFLAPSSSTPFNWLEASTGGSILPQARNFPGFNRSRNVGSMSLSSTADDMAGAVDVSDGGNAVNAMYLPVQDGTYHQHVILGAPLAPEAIAGAATSGFQHHVQISGVNWNP

43.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NAM-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here